General Information

  • ID:  hor001061
  • Uniprot ID:  Q9BH17
  • Protein name:  FMRFamide-related peptide
  • Gene name:  flp-2
  • Organism:  Globodera pallida (Potato cyst nematode)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  the lumbar ganglia and pre-anal ganglia along with the BDU neurones and a number of cells in the retrovesicular ganglion
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Globodera (genus), Heteroderinae (subfamily), Heteroderidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  KNKFEFIRF
  • Length:  9
  • Propeptide:  MIQQIPTALLLVTLATALLMLSGVKTNAQNAHLLVERDFGNAERVNDRPMNGVDGEVIDKMESRLLGALELLQTYRDAPIVPKFTVKRKNKFEFIRFGKRRR
  • Signal peptide:  MIQQIPTALLLVTLATA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of both dorsal and ventral body wall muscles, the musculature of the vulva and in the function of a number of sensory structures in both the head and tail
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BH17-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001061_AF2.pdbhor001061_ESM.pdb

Physical Information

Mass: 137132 Formula: C60H89N15O13
Absent amino acids: ACDGHLMPQSTVWY Common amino acids: F
pI: 10.79 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -71.11 Boman Index: -2561
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 3520 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12117492
  • Title:  Localisation of Globodera Pallida FMRFamide-related Peptide Encoding Genes Using in Situ Hybridisation